BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Serine/threonine-protein kinase SRPK1
Syringe Reactant:BDBM221074
Meas. Tech.:Enzyme Inhibition
Entry Date:04/06/17
 
ΔG°:-9.92± (kcal/mole)
pH:7.5±0
Log10Kb:7.14± 8.30
Temperature:303.15±0 (K)
ΔH° :-5.98±0.190 (kcal/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :0.0100±0 (kcal/mole-K)
Comments:n/a
 
Citation Batson, JToop, HDRedondo, CBabaei-Jadidi, RChaikuad, AWearmouth, SFGibbons, BAllen, CTallant, CZhang, JDu, CHancox, JCHawtrey, TDa Rocha, JGriffith, RKnapp, SBates, DOMorris, JC Development of Potent, Selective SRPK1 Inhibitors as Potential Topical Therapeutics for Neovascular Eye Disease. ACS Chem Biol12:825-832 (2017) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
Serine/threonine-protein kinase SRPK1
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Serine/threonine-protein kinase SRPK1
Synonyms:SRPK1 | SRSF protein kinase 1 (SRPK1) | Serine/arginine-protein kinase 1 (SRPK1)
Type:Protein
Mol. Mass.:74318.38
Organism:Homo sapiens (Human)
Description:Q96SB4
Residue:655
Sequence:
MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPN
DYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTET
ALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSN
YQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQR
SGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQ
KRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGGAAEINCNGVI
EVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSE
VSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLV
NPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACM
AFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHI
TKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM221074
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM221074
Synonyms:SPHINX31 | US9695160, 12 | US9796707, Compound 12
TypeSmall organic molecule
Emp. Form.C27H24F3N5O2
Mol. Mass.507.507
SMILESFC(F)(F)c1ccc(N2CCN(Cc3ccccn3)CC2)c(NC(=O)c2ccc(o2)-c2ccncc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.