BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Ephrin type-A receptor 4 ligand binding domain (I59G-EphA4-LBD)
Syringe Reactant:BDBM223311
Meas. Tech.:Enzyme Inhibition
Entry Date:04/27/17
 
ΔG°:-30.8± (kJ/mole)
pH:6.5±0
Log10Kb:5.36± n/a
Temperature:300.15±0 (K)
ΔH° :-23.8±3.10 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.0234±0 (kJ/mole-K)
Comments:n/a
 
Citation Wu, BDe, SKKulinich, ASalem, AFKoeppen, JWang, RBarile, EWang, SZhang, DEthell, IPellecchia, M Potent and Selective EphA4 Agonists for the Treatment of ALS. Cell Chem Biol24:293-305 (2017) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
Ephrin type-A receptor 4 ligand binding domain (I59G-EphA4-LBD)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Ephrin type-A receptor 4 ligand binding domain (I59G-EphA4-LBD)
Synonyms:n/a
Type:Protein
Mol. Mass.:20794.34
Organism:Homo sapiens (Human)
Description:Human EphA4-LBD I59G mutant
Residue:181
Sequence:
NEVTLLDSRSVQGELGWIASPLEGGWEEVSGMDEKNTPIRTYQVCNVMEPSQNNWLRTDW
ITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTI
AADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTV
R
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223311
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM223311
Synonyms:123C4
TypeSmall organic molecule
Emp. Form.C43H47ClN8O6
Mol. Mass.807.336
SMILESCOc1ccc2[nH]cc(CCNC(=O)[C@H](Cc3ccncc3)NC(=O)[C@H](Cc3ccc(Cl)cc3)NC(=O)[C@H](Cc3c[nH]c4ccc(O)cc34)NC(=O)CCCN)c2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.