BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Mannoprotein ligand-binding domain 2 (Mp1p-LBD2 I332A)
Syringe Reactant:BDBM22319
Meas. Tech.:Enzyme Inhibition
Entry Date:04/28/17
 
ΔG°:-34.3± (kJ/mole)
pH:8±0
Log10Kb:5.77± 5.77
Temperature:310.15±0 (K)
ΔH° :-60.7±0 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.087±0 (kJ/mole-K)
Comments:n/a
 
Citation Sze, KHLam, WHZhang, HKe, YHTse, MKWoo, PCLau, SKLau, CCCai, JPTung, ETLo, RKXu, SKao, RYHao, QYuen, KY Talaromyces marneffei Mp1p Is a Virulence Factor that Binds and Sequesters a Key Proinflammatory Lipid to Dampen Host Innate Immune Response. Cell Chem Biol24:182-194 (2017) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
Mannoprotein ligand-binding domain 2 (Mp1p-LBD2 I332A)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Mannoprotein ligand-binding domain 2 (Mp1p-LBD2 I332A)
Synonyms:n/a
Type:Protein
Mol. Mass.:17223.48
Organism:Talaromyces marneffei
Description:T. marneffei Mp1p-LBD2 I332A mutant
Residue:160
Sequence:
TKVKREATKVQRDISAFKKVIQNISLAVNKFNVDIERYVGGDASHLLADGNVLIKATLDG
VQSLQNEPPLSSMEALALVGPVQDLSNQILLAIQNLIDKKEPLVQAGFGGKVENNLRQQE
EAAQKLSELVSTKVPHELADISRQLSDGIAAGAKKGIDAF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22319
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM22319
Synonyms:(5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenoic acid | Arachidonic acid | Arachidonic acid (AA) | CHEMBL15594 | [1-14C]Arachidonic acid
TypeUnsaturated fatty acid
Emp. Form.C20H32O2
Mol. Mass.304.4669
SMILESCCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.