BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Na+/H+ exchanger regulatory factor-1 PDZ domain (PDZ1)
Syringe Reactant:BDBM228843
Meas. Tech.:Enzyme Inhibition
Entry Date:05/30/17
 
ΔG°:-26±1 (kJ/mole)
pH:8±0
Log10Kb:7.61± 6.00
Temperature:298.15±0 (K)
ΔH° :-15.9±0.800 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.034±0.00300 (kJ/mole-K)
Comments:n/a
 
Citation Mamonova, TZhang, QChandra, MCollins, BMSarfo, EBu, ZXiao, KBisello, AFriedman, PA Origins of PDZ Binding Specificity. A Computational and Experimental Study Using NHERF1 and the Parathyroid Hormone Receptor. Biochemistry56:2584-2593 (2017) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info
 
Na+/H+ exchanger regulatory factor-1 PDZ domain (PDZ1)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Na+/H+ exchanger regulatory factor-1 PDZ domain (PDZ1)
Synonyms:n/a
Type:Protein
Mol. Mass.:14899.03
Organism:Homo sapiens (Human)
Description:PDZ1 domain of human NHERF1 (1-140 aa)
Residue:140
Sequence:
MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQA
EPPAAAEVQGAGNENEPREA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM228843
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM228843
Synonyms:PTHRct-8 mutant (QAAWETVM) | QAAWETVM
TypeSmall organic molecule
Emp. Form.C41H62N10O13S
Mol. Mass.935.055
SMILESCSCC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(N)=O)[C@@H](C)O)C(C)C)C(O)=O |r|
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.