BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Thiol:disulfide interchange protein (DsbA)
Syringe Reactant:BDBM231639
Meas. Tech.:Enzyme Inhibition
Entry Date:06/06/17
 
ΔG°:-1.94± (kcal/mole)
pH:7.4±0
Log10Kb:1.41± n/a
Temperature:298.15±0 (K)
ΔH° :-5.5±0.190 (kcal/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :-0.0100±0 (kcal/mole-K)
Comments:Mixed (oxidized & reduced) AbDsbA
 
Citation Premkumar, LKurth, FDuprez, WGr°ftehauge, MKKing, GJHalili, MAHeras, BMartin, JL Structure of the Acinetobacter baumannii dithiol oxidase DsbA bound to elongation factor EF-Tu reveals a novel protein interaction site. J Biol Chem289:19869-80 (2014) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
Thiol:disulfide interchange protein (DsbA)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Thiol:disulfide interchange protein (DsbA)
Synonyms:n/a
Type:Protein
Mol. Mass.:20315.10
Organism:Acinetobacter baumannii (AYE strain)
Description:A. baumannii DsbA lacking the predicted periplasmic leader sequence (27-205 aa)
Residue:179
Sequence:
AGKDYTVIANPGKVEVPGKIEVREFFWYGCPHCFKLEPHMQTWLKQIPSDVRFVRTPAAM
NKVWEQGARTYYTSEALGVRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNS
TYNSFAVTAKVAESNKLAQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM231639
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM231639
Synonyms:AFDQIDNAPEE
TypeSmall organic molecule
Emp. Form.C53H77N13O22
Mol. Mass.1248.2524
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r|
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.