BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:AbDsbA(ox)/AFDQIDNAPEE
Syringe Reactant:BDBM231642
Meas. Tech.:Enzyme Inhibition
Entry Date:06/06/17
 
ΔG°:-51.0± (kJ/mole)
pH:7.4±0
Log10Kb:8.94± n/a
Temperature:298.15±0 (K)
ΔH° :-40±2 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.037±0 (kJ/mole-K)
Comments:Oxidized AbDsbA with AFDQIDNAPEE
 
Citation Premkumar, LKurth, FDuprez, WGr°ftehauge, MKKing, GJHalili, MAHeras, BMartin, JL Structure of the Acinetobacter baumannii dithiol oxidase DsbA bound to elongation factor EF-Tu reveals a novel protein interaction site. J Biol Chem289:19869-80 (2014) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
AbDsbA(ox)/AFDQIDNAPEE
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:AbDsbA(ox)/AFDQIDNAPEE
Synonyms:n/a
Type:Protein
Mol. Mass.:n/a
Description:Oxidized AbDsbA with AFDQIDNAPEE
Components:This complex has 2 components.
Component 1
Name:Thiol:disulfide interchange protein (DsbA)
Synonyms:n/a
Type:Protein
Mol. Mass.:20315.10
Organism:Acinetobacter baumannii (AYE strain)
Description:A. baumannii DsbA lacking the predicted periplasmic leader sequence (27-205 aa)
Residue:179
Sequence:
AGKDYTVIANPGKVEVPGKIEVREFFWYGCPHCFKLEPHMQTWLKQIPSDVRFVRTPAAM
NKVWEQGARTYYTSEALGVRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNS
TYNSFAVTAKVAESNKLAQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
NameBDBM231639
Synonyms:AFDQIDNAPEE
TypeSmall organic molecule
Emp. Form.C53H77N13O22
Mol. Mass.1248.2524
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM231642
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM231642
Synonyms:PSCGPGL
TypeSmall organic molecule
Emp. Form.C26H43N7O9S
Mol. Mass.629.726
SMILESCC(C)C[C@H](NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CS)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.