BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Nuclear receptor REV-ERBβ ligand-binding domain (REV-ERBβ-LBD)
Syringe Reactant:BDBM231645
Meas. Tech.:Enzyme Inhibition
Entry Date:06/06/17
 
ΔG°:-36.8± (kJ/mole)
pH:7.5±0
Log10Kb:6.45± 6.45
Temperature:298.15±0 (K)
ΔH° :-104±0 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.232±0 (kJ/mole-K)
Comments:n/a
 
Citation Matta-Camacho, EBanerjee, SHughes, TSSolt, LAWang, YBurris, TPKojetin, DJ Structure of REV-ERB▀ ligand-binding domain bound to a porphyrin antagonist. J Biol Chem289:20054-66 (2014) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
Nuclear receptor REV-ERBβ ligand-binding domain (REV-ERBβ-LBD)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Nuclear receptor REV-ERBβ ligand-binding domain (REV-ERBβ-LBD)
Synonyms:n/a
Type:Protein
Mol. Mass.:22445.55
Organism:Homo sapiens (Human)
Description:Human REV-ERBβ-LBD (381-579 aa)
Residue:199
Sequence:
HLVCPLSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKA
GTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSD
EEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPD
LRSLNNMHSEELLAFKVHP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM231645
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM231645
Synonyms:Heme
TypeSmall organic molecule
Emp. Form.C34H32FeN4O4
Mol. Mass.616.487
SMILESCC1=C(CCC(O)=O)C2=[N]3C1=Cc1c(C=C)c(C)c4C=C5C(C=C)=C(C)C6=[N]5[Fe]3(n14)n1c(=C6)c(C)c(CCC(O)=O)c1=C2 |c:1,8,27,36,48,t:11,20,24|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.