Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-hexosaminidase subunit beta (Hex B)
LigandBDBM304327
Substrate/Competitorn/a
Meas. Tech.Inhibition of Mast Cell Degranulation
IC50 3800±n/a nM
Citation Schlechtingen, GKnolker, HFriedrichson, TJennings, GBraxmeier, T Hydroxy-substituted amino and ammonium derivatives and their medical use US Patent US10143668 Publication Date 12/4/2018
More Info.:Get all data from this article,  Assay Method
 
Beta-hexosaminidase subunit beta (Hex B)
Name:Beta-hexosaminidase subunit beta (Hex B)
Synonyms:Beta-N-acetylhexosaminidase subunit beta | Beta-hexosaminidase subunit beta | HEXB | Hexosaminidase subunit B
Type:Enzyme
Mol. Mass.:63112.58
Organism:Homo sapiens (Human)
Description:P07686
Residue:556
Sequence:
MELCGLGLPRPPMLLALLLATLLAAMLALLTQVALVVQVAEAARAPSVSAKPGPALWPLP
LSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFGFYKWHHEPAEFQA
KTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVY
QDSYGTFTINESTIIDSPRFSHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVD
DQSFPYQSITFPELSNKGSYSLSHVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGK
GQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKC
WESNPKIQDFMRQKGFGTDFKKLESFYIQKVLDIIATINKGSIVWQEVFDDKAKLAPGTI
VEVWKDSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQKQKQL
FIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRMVERG
IAAQPLYAGYCNHENM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM304327
NameBDBM304327
Synonyms:US10143668, Compound 1a
TypeSmall organic molecule
Emp. Form.C25H53N2O6
Mol. Mass.477.6976
SMILESCCCCCCCCCCCCCC[N+](C)(C)CC(=O)N(C)C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a