Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKeap1 (321-609)
LigandBDBM304728
Substrate/Competitorn/a
Meas. Tech.Nrf2-Keap1 FP Assay #1
IC50 55±n/a nM
Citation Davies, TGWoolford, AJWillems, HMNorton, DHeightman, TDKerns, JK Nrf2 regulators US Patent US10144731 Publication Date 12/4/2018
More Info.:Get all data from this article,  Assay Method
 
Keap1 (321-609)
Name:Keap1 (321-609)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:31620.58
Organism:Homo sapiens (Human)
Description:n/a
Residue:289
Sequence:
APKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGR
NNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSV
ERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMI
TAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGIT
VHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM304728
NameBDBM304728
Synonyms:3-(7-methoxy-1-methyl-1H-benzo[d][1,2,3]triazol-5-yl)-3-(4-methyl-3-(((S)-4-methyl-1,1-dioxido-3,4-dihydro-2H-benzo[b][1,4,5]oxathiazepin-2-yl)methyl)phenyl)propanoic acid | US10144731, Example 14
TypeSmall organic molecule
Emp. Form.C28H30N4O6S
Mol. Mass.550.626
SMILESCOc1cc(cc2nnn(C)c12)C(CC(O)=O)c1ccc(C)c(CN2C[C@H](C)Oc3ccccc3S2(=O)=O)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a