Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKeap1 (321-609)
LigandBDBM304887
Substrate/Competitorn/a
Meas. Tech.Nrf2-Keap1 FP Assay #1
IC50<10±n/a nM
Citation Davies, TGWoolford, AJWillems, HMNorton, DHeightman, TDKerns, JK Nrf2 regulators US Patent US10144731 Publication Date 12/4/2018
More Info.:Get all data from this article,  Assay Method
 
Keap1 (321-609)
Name:Keap1 (321-609)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:31620.58
Organism:Homo sapiens (Human)
Description:n/a
Residue:289
Sequence:
APKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGR
NNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSV
ERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMI
TAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGIT
VHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM304887
NameBDBM304887
Synonyms:3-(3-(((R)-4-ethyl-1,1-dioxido-3,4-dihydro-2H-benzo[b][1,4,5]oxathiazepin-2-yl)methyl)-4-methylphenyl)-5-(1-ethyl-1H-1,2,3-triazol-4-yl)-2-methylpentanoic acid | US10144731, Example 192
TypeSmall organic molecule
Emp. Form.C28H36N4O5S
Mol. Mass.540.674
SMILESCC[C@@H]1CN(Cc2cc(ccc2C)C(CCc2cn(CC)nn2)C(C)C(O)=O)S(=O)(=O)c2ccccc2O1 |r,w:14.14,23.25|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a