Target
Tyrosine-protein kinase JAK2 [828-1132]
Ligand
BDBM400287
Substrate
n/a
IC50
<10±n/a nM
Citation
 Huang, TXue, C Piperidin-4-yl azetidine derivatives as JAK1 inhibitors US Patent  US11285140 Publication Date 3/29/2022
Target
Name:
Tyrosine-protein kinase JAK2 [828-1132]
Synonyms:
JAK2 (aa 828-1132) | Tyrosine-protein kinase JAK2
Type:
n/a
Mol. Mass.:
35579.28
Organism:
Homo sapiens (Human)
Description:
O60674[828-1132]
Residue:
305
Sequence:
GALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
  
Inhibitor
Name:
BDBM400287
Synonyms:
US10695337, Example 41 | US11285140, Example 41 | US9999619, Example 42
Type:
Small organic molecule
Emp. Form.:
C26H24F2N8O
Mol. Mass.:
502.5186
SMILES:
Fc1cccc(C(=O)N2CCC(CC2)N2CC(CC#N)(C2)n2cc(cn2)-c2ncnc3[nH]ccc23)c1F
Structure:
Search PDB for entries with ligand similarity: