Target
Tyrosine-protein kinase JAK2 [828-1132]
Ligand
BDBM400599
Substrate
n/a
IC50
<10±n/a nM
Citation
 Huang, TXue, C Piperidin-4-yl azetidine derivatives as JAK1 inhibitors US Patent  US11285140 Publication Date 3/29/2022
Target
Name:
Tyrosine-protein kinase JAK2 [828-1132]
Synonyms:
JAK2 (aa 828-1132) | Tyrosine-protein kinase JAK2
Type:
n/a
Mol. Mass.:
35579.28
Organism:
Homo sapiens (Human)
Description:
O60674[828-1132]
Residue:
305
Sequence:
GALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
  
Inhibitor
Name:
BDBM400599
Synonyms:
US10695337, Example 355 | US11285140, Example 355 | US9999619, Example 355 | {3-[4-(5-Fluoro-1H-pyrrolo[2,3-b]pyridin-4-yl)-1H-pyrazol-1-yl]-1-[1-(methylsulfonyl)piperidin-4-yl]azetidin-3-yl}acetonitrile
Type:
Small organic molecule
Emp. Form.:
C21H24FN7O2S
Mol. Mass.:
457.524
SMILES:
CS(=O)(=O)N1CCC(CC1)N1CC(CC#N)(C1)n1cc(cn1)-c1c(F)cnc2[nH]ccc12
Structure:
Search PDB for entries with ligand similarity: