Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
LigandBDBM308608
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
Ki<10.00±n/a nM
Citation Amberg, WPohlki, FLange, UWang, YXZhao, HHLi, HBrewer, JTZanze, IDietrich, JVasudevan, ADjuric, SWLao, YHutchins, CW Pyrrolidine derivatives, pharmaceutical compositions containing them, and their use in therapy US Patent US9656955 Publication Date 5/23/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
Name:Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
Synonyms:GGNT1 | GLCT1 | GLYT1 | GNT-I | GlcNAc-T I | MGAT | MGAT1 | N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I
Type:PROTEIN
Mol. Mass.:50891.32
Organism:Homo sapiens (Human)
Description:ChEMBL_107587
Residue:445
Sequence:
MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQD
AEVELERQRGLLQQIGDALSSQRGRVPTAAPPAQPRVPVTPAPAVIPILVIACDRSTVRR
CLDKLLHYRPSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQ
GYYKIARHYRWALGQVFRQFRFPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSA
WNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQG
RACIRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQREAYDRDFLA
RVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIV
TFQFRGRRVHLAPPLTWEGYDPSWN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM308608
NameBDBM308608
Synonyms:BDBM308811 | US9656955, Example 94 | trans-N-(3-chlorophenyl)-4-(4-fluorophenyl)-1-[(1-methyl-1H-imidazol-4-yl)sulfonyl]pyrrolidin-3-amine
TypeSmall Organic Molecule
Emp. Form.C20H20ClFN4O2S
Mol. Mass.434.915
SMILESCn1cnc(c1)S(=O)(=O)N1C[C@@H](Nc2cccc(Cl)c2)[C@@H](C1)c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a