Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAP2-associated protein kinase 1
LigandBDBM311289
Substrate/Competitorn/a
Meas. Tech.AAK1 Kinase Assay
IC50 0.240±n/a nM
Citation Luo, GDzierba, CDMacor, JE Biaryl kinase inhibitors US Patent US10155760 Publication Date 12/18/2018
More Info.:Get all data from this article,  Assay Method
 
AP2-associated protein kinase 1
Name:AP2-associated protein kinase 1
Synonyms:AAK1 | Adaptor-associated kinase 1 | KIAA1048
Type:PROTEIN
Mol. Mass.:103884.23
Organism:Homo sapiens (Human)
Description:ChEMBL_774569
Residue:961
Sequence:
MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIV
FLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVW
EVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVE
NILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIIT
TKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDK
RPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTT
ETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPPQAAGSSNQPGLLASVPQPKP
QAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQQLFLKQQQQQQQPPP
AQQQPAGTFYQQQQAQTQQFQAVHPATQKPAIAQFPVVSQGGSQQQLMQNFYQQQQQQQQ
QQQQQQLATALHQQQLMTQQAALQQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQ
PKVQTTPPPAVQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLQAAA
AEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDDDNFSKLTAEELLNKDFAKLG
EGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFI
PLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIEKADVAVESLIPGLEPPV
PQRLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTTDLLEEFAPTAISAPVHKAAEDSNL
ISGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARSLLLVDQLID
L
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM311289
NameBDBM311289
Synonyms:(S)-2,4-dimethyl-1-((6-(quinolin-4-yl)-4-(trifluoromethyl)pyridin-3-yl)oxy)pentan-2-amine | US10155760, Example 145
TypeSmall organic molecule
Emp. Form.C22H24F3N3O
Mol. Mass.403.4407
SMILESCC(C)C[C@](C)(N)COc1cnc(cc1C(F)(F)F)-c1ccnc2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a