Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 3 Bromo 1 domain(BRD3 BD1)
LigandBDBM50092310
Substrate/Competitorn/a
Meas. Tech.FP Competitive Binding Assay (No.350)
Temperature298.15±n/a K
Ki 7.30±0.10 nM
Commentsextracted
Citation Wang, SRan, XZhao, YYang, CLiu, LBai, LMcEachern, DStuckey, JMeagher, JLSun, DLi, XZhou, BKaratas, HLuo, RChinnaiyan, AAsangani, IA BET bromodomain inhibitors and therapeutic methods using the same US Patent US9675697 Publication Date 6/13/2017
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 3 Bromo 1 domain(BRD3 BD1)
Name:Bromodomain-containing protein 3 Bromo 1 domain(BRD3 BD1)
Synonyms:n/a
Type:n/a
Mol. Mass.:8887.10
Organism:Homo sapiens (Human)
Description:BD1 (51-123 aa) of Q15059
Residue:73
Sequence:
WKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFT
NCYIYNKPTDDIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50092310
NameBDBM50092310
Synonyms:CHEMBL3581661 | US9675697, Cpd. No. 23
TypeSmall organic molecule
Emp. Form.C24H23N5O2
Mol. Mass.413.4717
SMILESCOc1cc2c(cc1-c1c(C)noc1C)[nH]c1ccnc(-c3c(C)[nH]nc3C3CC3)c21 |(5.34,2.95,;5.34,1.67,;3.96,.87,;2.62,1.63,;1.3,.87,;1.3,-.64,;2.62,-1.4,;3.96,-.64,;5.34,-1.44,;5.49,-3.01,;4.53,-3.86,;7.04,-3.34,;7.84,-1.97,;6.77,-.78,;7.03,.46,;,-1.4,;-1.3,-.64,;-2.64,-1.4,;-3.92,-.64,;-3.92,.87,;-2.64,1.63,;-2.66,3.22,;-3.96,4.12,;-5.16,3.71,;-3.48,5.64,;-1.89,5.66,;-1.38,4.15,;.14,3.67,;1.21,2.62,;1.55,4.18,;-1.3,.87,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a