Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
LigandBDBM179474
Substrate/Competitorn/a
Meas. Tech.FP Competitive Binding Assay (No.350)
Temperature298.15±n/a K
Ki 27±1.00 nM
Commentsextracted
Citation Wang, SRan, XZhao, YYang, CLiu, LBai, LMcEachern, DStuckey, JMeagher, JLSun, DLi, XZhou, BKaratas, HLuo, RChinnaiyan, AAsangani, IA BET bromodomain inhibitors and therapeutic methods using the same US Patent US9675697 Publication Date 6/13/2017
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
Name:Bromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
Synonyms:Bromodomain-containing protein 4 (BD1) | Bromodomain-containing protein 4 Bromodomain 1 (BRD4-1) | Bromodomain-containing protein 4 Domain 1
Type:n/a
Mol. Mass.:8856.55
Organism:Homo sapiens (Human)
Description:BD1 (75-147 aa) of O60885
Residue:73
Sequence:
WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFT
NCYIYNKPGDDIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM179474
NameBDBM179474
Synonyms:US9675697, Cpd. No. 25
TypeSmall organic molecule
Emp. Form.C27H22N5O2
Mol. Mass.448.4959
SMILESCOc1cc2c(cc1-c1c(C)noc1C)[nH]c1ccnc(-c3c(C)nnc3-c3ccccc3)c21 |(-1.5,3.22,;-2.13,1.81,;-1.36,.48,;.18,.48,;.95,-.85,;.18,-2.19,;-1.36,-2.19,;-2.13,-.85,;-3.67,-.85,;-4.57,-2.1,;-4.18,-3.59,;-6.04,-1.62,;-6.04,-.08,;-4.57,.39,;-4.18,1.88,;1.21,-3.33,;2.62,-2.71,;4.03,-3.33,;5.27,-2.43,;5.11,-.9,;3.7,-.27,;3.31,1.22,;2.06,2.12,;.57,1.72,;2.54,3.59,;4.08,3.59,;4.55,2.12,;6.04,1.72,;6.36,.22,;7.82,-.26,;8.97,.77,;8.65,2.28,;7.18,2.76,;2.46,-1.17,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a