Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
LigandBDBM186322
Substrate/Competitorn/a
Meas. Tech.FP Competitive Binding Assay (No.350)
Temperature298.15±n/a K
Ki 1243±549 nM
Commentsextracted
Citation Wang, SRan, XZhao, YYang, CLiu, LBai, LMcEachern, DStuckey, JMeagher, JLSun, DLi, XZhou, BKaratas, HLuo, RChinnaiyan, AAsangani, IA BET bromodomain inhibitors and therapeutic methods using the same US Patent US9675697 Publication Date 6/13/2017
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
Name:Bromodomain-containing protein 4 Bromo 1 domain(BRD4 BD1)
Synonyms:Bromodomain-containing protein 4 (BD1) | Bromodomain-containing protein 4 Bromodomain 1 (BRD4-1) | Bromodomain-containing protein 4 Domain 1
Type:n/a
Mol. Mass.:8856.55
Organism:Homo sapiens (Human)
Description:BD1 (75-147 aa) of O60885
Residue:73
Sequence:
WKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFT
NCYIYNKPGDDIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM186322
NameBDBM186322
Synonyms:US9675697, RX-39
Typen/a
Emp. Form.C18H16ClN3O2
Mol. Mass.341.792
SMILESCCc1noc(C)c1-c1cc2[nH]c3ccnc(Cl)c3c2cc1OC |(3.09,-3.38,;4.56,-3.87,;5.51,-3.02,;7.06,-3.35,;7.86,-1.97,;6.79,-.79,;7.05,.46,;5.36,-1.45,;3.99,-.65,;2.65,-1.4,;1.32,-.65,;.02,-1.4,;-1.28,-.65,;-2.62,-1.4,;-3.9,-.65,;-3.9,.87,;-2.62,1.63,;-2.64,3.17,;-1.28,.87,;1.32,.87,;2.65,1.63,;3.99,.87,;5.36,1.67,;5.36,2.94,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a