Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 2 Bromo 1 domain(BRD2 BD1)
LigandBDBM179490
Substrate/Competitorn/a
Meas. Tech.FP Competitive Binding Assay (No.350)
Temperature298.15±n/a K
Ki 4.30±n/a nM
Commentsextracted
Citation Wang, SRan, XZhao, YYang, CLiu, LBai, LMcEachern, DStuckey, JMeagher, JLSun, DLi, XZhou, BKaratas, HLuo, RChinnaiyan, AAsangani, IA BET bromodomain inhibitors and therapeutic methods using the same US Patent US9675697 Publication Date 6/13/2017
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 2 Bromo 1 domain(BRD2 BD1)
Name:Bromodomain-containing protein 2 Bromo 1 domain(BRD2 BD1)
Synonyms:n/a
Type:n/a
Mol. Mass.:8836.08
Organism:Homo sapiens (Human)
Description:BD1 (91-163 aa) of P25440
Residue:73
Sequence:
WKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFT
NCYIYNKPTDDIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM179490
NameBDBM179490
Synonyms:US9675697, Cpd. No. 196
TypeSmall organic molecule
Emp. Form.C34H34N6O3
Mol. Mass.574.6722
SMILESCOc1cc2c(cc1-c1c(C)noc1C)[nH]c1nc(C)nc(-c3ccc(C(=O)NC4CCN(C)CC4)c4ccccc34)c21 |(-1.5,3.22,;-2.13,1.81,;-1.36,.48,;.18,.48,;.95,-.85,;.18,-2.19,;-1.36,-2.19,;-2.13,-.85,;-3.67,-.85,;-4.57,-2.1,;-4.18,-3.59,;-6.04,-1.62,;-6.04,-.08,;-4.57,.39,;-4.18,1.88,;1.21,-3.33,;2.62,-2.71,;4.03,-3.33,;5.27,-2.43,;6.68,-3.05,;5.11,-.9,;3.7,-.27,;3.54,1.26,;2.14,1.89,;1.97,3.42,;3.22,4.33,;3.06,5.86,;4.31,6.76,;1.65,6.48,;1.49,8.01,;2.74,8.92,;2.58,10.45,;1.17,11.08,;1.01,12.61,;-.08,10.17,;.09,8.64,;4.63,3.7,;5.87,4.6,;7.28,3.98,;7.44,2.45,;6.2,1.54,;4.79,2.17,;2.46,-1.17,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a