Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty acid-binding protein 4 (FABP4)
LigandBDBM312490
Substrate/Competitorn/a
Meas. Tech.Time Resolved-Fluorescence Energy Transfer (TR-FRET) Assay
IC50 10.00±n/a nM
Citation Buettelmann, BCeccarelli, SMKuehne, HKuhn, BNeidhart, WObst Sander, URichter, H Bicyclic thiophenylamide compounds US Patent US9604977 Publication Date 3/28/2017
More Info.:Get all data from this article,  Assay Method
 
Fatty acid-binding protein 4 (FABP4)
Name:Fatty acid-binding protein 4 (FABP4)
Synonyms:A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | Fatty acid binding protein adipocyte | Fatty acid-binding protein 4
Type:Enzyme
Mol. Mass.:14719.23
Organism:Homo sapiens (Human)
Description:P15090
Residue:132
Sequence:
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM312490
NameBDBM312490
Synonyms:2-[3-(3-Cyclopropyl-[1,2,4]oxadiazol-5-yl)-5,5-dimethyl-4,5,6,7-tetrahydro-benzo[b]thiophen-2-ylcarbamoyl]-cyclopent-1-enecarboxylic acid | US9604977, Example 236
TypeSmall organic molecule
Emp. Form.C22H25N3O4S
Mol. Mass.427.517
SMILESCC1(C)CCc2sc(NC(=O)C3=C(CCC3)C(O)=O)c(-c3nc(no3)C3CC3)c2C1 |t:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a