Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP2 subtype
LigandBDBM180024
Substrate/Competitorn/a
Meas. Tech.Binding Assay
pH6±n/a
Ki 1.20±n/a nM
Commentsextracted
Citation Shibakawa, NYoneda, KKatsube, TKanda, TIto, KYamamoto, KIwase, NUshiyama, S Substituted biaryl compound US Patent US9676720 Publication Date 6/13/2017
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP2 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostanoid EP2 Receptor
Type:Enzyme
Mol. Mass.:39775.71
Organism:Homo sapiens (Human)
Description:P43116
Residue:358
Sequence:
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM180024
NameBDBM180024
Synonyms:US9676720, Comparative example 11
TypeSmall organic molecule
Emp. Form.C27H26N4O5S
Mol. Mass.518.584
SMILESCOc1cccc(c1)-c1ccc(CN(Cc2cccc(NCC(O)=O)n2)S(=O)(=O)c2ccccn2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a