Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetJAK2 (aa808-1132)
LigandBDBM264210
Substrate/Competitorn/a
Meas. Tech.Enzyme Inhibition Studies
IC50 19800±n/a nM
Citation Astrand, AGrimster, NKawatkar, SKettle, JGNilsson, MKRuston, LSu, QVasbinder, MWinter-Holt, JJWoessner, RDChuaqui, CEMcCabe, J Compounds and methods for inhibiting JAK US Patent US10167276 Publication Date 1/1/2019
More Info.:Get all data from this article,  Assay Method
 
JAK2 (aa808-1132)
Name:JAK2 (aa808-1132)
Synonyms:n/a
Type:Protein
Mol. Mass.:39171.39
Organism:Homo sapiens (Human)
Description:n/a
Residue:335
Sequence:
FRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGK
GNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVC
YSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDL
ATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDV
WSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDE
IYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM264210
NameBDBM264210
Synonyms:(2R)-2-[(3S)-3,4- dimethylpiperazin-1- yl]-N-(3-{2-[(3-ethoxy- 1-methyl-1H- pyrazol-4-yl)amino]-5- methylpyrimidin-4-yl}- 1H-indol-7- yl)propanamide | US10167276, Example 31a | US9714236, 31a
TypeSmall organic molecule
Emp. Form.C28H37N9O2
Mol. Mass.531.6525
SMILESCCOc1nn(C)cc1Nc1ncc(C)c(n1)-c1c[nH]c2c(NC(=O)[C@@H](C)N3CCN(C)[C@@H](C)C3)cccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a