Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 2 Bromo 1 domain(BRD2 BD1)
LigandBDBM313787
Substrate/Competitorn/a
Meas. Tech.Binding Assay
IC50 550±n/a nM
Citation Burns, CGarnier, JSharp, PPFeutrill, JCuzzupe, A Benzodiazepines as bromodomain inhibitors US Patent US10167292 Publication Date 1/1/2019  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 2 Bromo 1 domain(BRD2 BD1)
Name:Bromodomain-containing protein 2 Bromo 1 domain(BRD2 BD1)
Synonyms:n/a
Type:n/a
Mol. Mass.:8836.08
Organism:Homo sapiens (Human)
Description:BD1 (91-163 aa) of P25440
Residue:73
Sequence:
WKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFT
NCYIYNKPTDDIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM313787
NameBDBM313787
Synonyms:US10167292, Example 31
TypeSmall organic molecule
Emp. Form.C19H17ClN4O2
Mol. Mass.368.817
SMILESCOC(=O)c1ccc2-c3c(C)nnn3CCN(c3ccc(Cl)cc3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a