Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium voltage-gated channel subfamily H member 2
LigandBDBM315820
Substrate/Competitorn/a
Meas. Tech.Kv11.1 (hERG) ION CHANNEL ACTIVITY (Patch Clamp Assay)
Ki>25000±n/a nM
Citation Fuchss, TEmde, UBuchstaller, HMederski, W Arylquinazolines US Patent US10172859 Publication Date 1/8/2019
More Info.:Get all data from this article,  Assay Method
 
Potassium voltage-gated channel subfamily H member 2
Name:Potassium voltage-gated channel subfamily H member 2
Synonyms:1,3-beta-glucan synthase component GLS2 | Eag-related protein 1 | Erg1 | Ether a-go-go related gene potassium channel (hERG) | Ether-a-go-go-related gene (HERG) | Ether-a-go-go-related gene potassium channel (hERG) | Ether-a-go-go-related gene potassium channel 1 | Ether-a-go-go-related gene potassium channel 1 (HERG) | Ether-a-go-go-related gene potassium channel 1 (hERG1) | Ether-a-go-go-related protein (hERG) | Ether-a-go-go-related protein 1 | Ether-a-go-go-related protein 1 (HERG) | Ether-a-go-go-related protein 1 (hERG) | H-ERG | HERG | Potassium voltage-gated channel subfamily H member 2 (hERG) | Transcriptional regulator ERG | Voltage-gated potassium channel subunit Kv11.1 | eag homolog | hERG Potassium Channel 1 | putative potassium channel subunit
Type:Multi-pass membrane protein
Mol. Mass.:126672.65
Organism:Homo sapiens (Human)
Description:Q12809
Residue:1159
Sequence:
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSV
RSGGAGGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSP
PRSAPGQLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPP
RHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIA
PKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIY
TAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANE
EVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLD
RYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSS
GLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVS
AIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGF
PECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALY
FISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLE
VLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTE
QPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSS
PRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTP
SLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSA
VTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPG
QLGALTSQPLHRHGSDPGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM315820
NameBDBM315820
Synonyms:US10172859, Example 241 | US10172859, Example 242 | US10172859, Example 258 | US10172859, Example 468 | US9732094, Example 258 | [2-Chloro-4-fluoro-5- [7-(2,2,3,3,5,5,6,6- octadeuteriomorpholin- 4-yl)quinazolin-4- yl]phenyl]-(3- methoxypyrazin-2- yl)methanol (Ena 2)see racemate
TypeSmall organic molecule
Emp. Form.C24H21ClFN5O3
Mol. Mass.481.907
SMILESCOc1nccnc1C(O)c1cc(c(F)cc1Cl)-c1ncnc2cc(ccc12)N1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a