Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIDH1 R132H
LigandBDBM280112
Substrate/Competitorn/a
Meas. Tech.In Vitro Assays for IDH1m (R132H or R132C) Inhibitors
IC50 550±n/a nM
Citation Konteatis, ZDPopovici-Muller, JTravins, JMZahler, RCai, ZZhou, D Therapeutically active compounds and their methods of use US Patent US10172864 Publication Date 1/8/2019
More Info.:Get all data from this article,  Assay Method
 
IDH1 R132H
Name:IDH1 R132H
Synonyms:Amyloid-beta 1-40 | IDH1(R132H) | Isocitrate dehydrogenase (IDH1)(R132H) | Isocitrate dehydrogenase 1 mutant (R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (R132H)
Type:Enzyme Catalytic Domain
Mol. Mass.:46641.74
Organism:Homo sapiens (Human)
Description:n/a
Residue:414
Sequence:
MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM280112
NameBDBM280112
Synonyms:US10028961, Compound 265 | US10172864, Compound 265
TypeSmall organic molecule
Emp. Form.C22H23ClF4N6
Mol. Mass.482.905
SMILESFC1(F)CC2(CC(C2)Nc2nc(NC3CC4(C3)CC(F)(F)C4)nc(n2)-c2cccc(Cl)n2)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a