Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 1A2
LigandBDBM316950
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50>10000±n/a nM
Citation Ibrahim, PNSpevak, WCho, HShi, SZhang, CZhang, Y Compounds and methods for kinase modulation, and indications therefor US Patent US9617267 Publication Date 4/11/2017
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 1A2
Name:Cytochrome P450 1A
Synonyms:1.14.14.1 | CYP1A2 | CYPIA2 | Cholesterol 25-hydroxylase | Cytochrome P(3)450 | Cytochrome P450 1A2 | Cytochrome P450 4 | Cytochrome P450-P3
Type:PROTEIN
Mol. Mass.:58423.38
Organism:Homo sapiens (Human)
Description:ChEMBL_109705
Residue:516
Sequence:
MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN
PHLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG
QSLTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELM
AGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP
ILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGN
LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS
DRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL
WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLE
FSVPPGVKVDLTPIYGLTMKHARCEHVQARLRFSIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM316950
NameBDBM316950
Synonyms:N-[2,4-Difluoro-3-(4-methyl- 7H-pyrrolo[2,3-d]pyrimidine- 5-carbonyl)-phenyl]-4- trifluoromethyl- benzenesulfonamide | US9617267, Compound P-1001
TypeSmall organic molecule
Emp. Form.C21H13F5N4O3S
Mol. Mass.496.41
SMILESCc1ncnc2[nH]cc(C(=O)c3c(F)ccc(NS(=O)(=O)c4ccc(cc4)C(F)(F)F)c3F)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a