Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase VA
LigandBDBM10889
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
Ki 174±n/a nM
Citation Nishimori, IVullo, DInnocenti, AScozzafava, AMastrolorenzo, ASupuran, CT Carbonic anhydrase inhibitors. The mitochondrial isozyme VB as a new target for sulfonamide and sulfamate inhibitors. J Med Chem48:7860-6 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase VA
Name:Carbonic anhydrase V
Synonyms:CA-VA | Carbonate dehydratase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase VA (CA VA)
Type:Enzyme
Mol. Mass.:34755.54
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:305
Sequence:
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPG
GTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPL
ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVI
GVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLT
ESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN
EGTRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10889
NameBDBM10889
Synonyms:2-methoxy-N-[(1-methylpyrrolidin-2-yl)methyl]-5-sulfamoylbenzamide | Sulmepride | Sulpiride (SLP)
TypeSmall organic molecule
Emp. Form.C14H21N3O4S
Mol. Mass.327.399
SMILESCOc1ccc(cc1C(=O)NCC1CCCN1C)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM10856
NameBDBM10856
Synonyms:Carbon Dioxide | methanedione
TypeSmall organic molecule
Emp. Form.CO2
Mol. Mass.44.0095
SMILESO=C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: