Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5-HT1A)
LigandBDBM319743
Substrate/Competitorn/a
Meas. Tech.5-HT1A Receptor Agonism Activity Test
EC50 0.750±n/a nM
Citation Jiang, HWang, ZLi, JZhang, RHe, YLiu, YBi, MLiu, ZTian, GChen, WYang, FWu, CWang, YJiang, XYin, JWang, GShen, J Heterocyclic compounds, process for preparation of the same and use thereof US Patent US10174011 Publication Date 1/8/2019
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A (5-HT1A)
Name:5-hydroxytryptamine receptor 1A (5-HT1A)
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM319743
NameBDBM319743
Synonyms:(3aR,4R,6aS)-4-(5-(4-(benzo[b]thiophen-4-yl)piperazin-1-yl)pentyl)tetrahydro-1H-thieno[3,4-d]imidazol-2(3H)-one | US10174011, Example 134
TypeSmall organic molecule
Emp. Form.C22H30N4OS2
Mol. Mass.430.63
SMILESO=C1N[C@@H]2CS[C@H](CCCCCN3CCN(CC3)c3cccc4sccc34)[C@@H]2N1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a