Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFLT3(D835Y)
LigandBDBM319752
Substrate/Competitorn/a
Meas. Tech.FLT3 Kinase assay
Kd 46±0.0 nM
Citation Czardybon, WBrzózka, KGalezowski, MWindak, RMilik, MZawadzka, MGuzik, PWincza, EProkop, MWiklik, KSabiniarz, ACholody, WMHorvath, RRzymski, T Benzimidazole derivatives as kinase inhibitors US Patent US10174013 Publication Date 1/8/2019
More Info.:Get all data from this article,  Assay Method
 
FLT3(D835Y)
Name:FLT3(D835Y)
Synonyms:FL cytokine receptor | Receptor-type tyrosine-protein kinase FLT3 (D835Y) | STK-1 | Stem cell tyrosine kinase 1 | Tyrosine Kinase FLT3 Mutant (D835Y)
Type:n/a
Mol. Mass.:112937.71
Organism:Homo sapiens (Human)
Description:P36888 D835Y
Residue:993
Sequence:
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARYIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM319752
NameBDBM319752
Synonyms:US10174013, Example 1A | US10174013, Example 1X | US10174013, Example 1Y
TypeSmall organic molecule
Emp. Form.C13H15Br2N5O2
Mol. Mass.433.099
SMILESCCn1c(nc2c(c(Br)c(Br)cc12)[N+]([O-])=O)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a