Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-acylethanolamine-hydrolyzing acid amidase
LigandBDBM319813
Substrate/Competitorn/a
Meas. Tech.Determining Endocannabinoid Hydrolase Activity
IC50>100000±n/a nM
Citation Liu, ZQiu, YRen, JLi, YYang, LZhu, C Substituted heterocyclic derivative, preparation method and use thereof US Patent US10174015 Publication Date 1/8/2019
More Info.:Get all data from this article,  Assay Method
 
N-acylethanolamine-hydrolyzing acid amidase
Name:N-acylethanolamine-hydrolyzing acid amidase
Synonyms:ASAH-like protein | ASAHL | Acid ceramidase-like protein | N-acylsphingosine amidohydrolase-like | N-acylsphingosine-amidohydrolase | NAAA | PLT
Type:Enzyme
Mol. Mass.:40073.12
Organism:Homo sapiens (Human)
Description:Q02083
Residue:359
Sequence:
MRTADREARPGLPSLLLLLLAGAGLSAASPPAAPRFNVSLDSVPELRWLPVLRHYDLDLV
RAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCDFMNLSLADCLLVNLAY
ESSVFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFIGYVGL
WTGQSPHKFTVSGDERDKGWWWENAIAALFRRHIPVSWLIRATLSESENFEAAVGKLAKT
PLIADVYYIVGGTSPREGVVITRNRDGPADIWPLDPLNGAWFRVETNYDHWKPAPKEDDR
RTSAIKALNATGQANLSLEALFQILSVVPVYNNFTIYTTVMSAGSPDKYMTRIRNPSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM319813
NameBDBM319813
Synonyms:US10174015, Compound 26
TypeSmall organic molecule
Emp. Form.C15H19N3O3
Mol. Mass.289.3297
SMILESO=C(C1CCN(Cc2ccncc2)CC1)N1CCOC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a