Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty-acid amide hydrolase 1
LigandBDBM319831
Substrate/Competitorn/a
Meas. Tech.Determining Endocannabinoid Hydrolase Activity
IC50>100000±n/a nM
Citation Liu, ZQiu, YRen, JLi, YYang, LZhu, C Substituted heterocyclic derivative, preparation method and use thereof US Patent US10174015 Publication Date 1/8/2019
More Info.:Get all data from this article,  Assay Method
 
Fatty-acid amide hydrolase 1
Name:Fatty-acid amide hydrolase 1
Synonyms:Anandamide amidohydrolase | Anandamide amidohydrolase 1 | FAAH | FAAH1 | Fatty Acid Amide Hydrolase (FAAH) | Fatty-acid amide hydrolase (FAAH) | Oleamide hydrolase 1
Type:Protein
Mol. Mass.:63071.19
Organism:Homo sapiens (Human)
Description:O00519
Residue:579
Sequence:
MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM319831
NameBDBM319831
Synonyms:US10174015, Compound 44
TypeSmall organic molecule
Emp. Form.C13H17N3O5
Mol. Mass.295.2912
SMILESO=C(CCCCCn1ccc(=O)[nH]c1=O)N1CCOC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a