Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 4A
LigandBDBM320363
Substrate/Competitorn/a
Meas. Tech.JMJD2A Assay
IC50<100±n/a nM
Citation Chen, YKWallace, MB Histone demethylase inhibitors US Patent US10174026 Publication Date 1/8/2019
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 4A
Name:Lysine-specific demethylase 4A
Synonyms:JmjC domain-containing histone demethylation protein 3A | Jumonji domain-containing protein 2A | Lysine-specific demethylase 4A
Type:Enzyme
Mol. Mass.:120647.83
Organism:Homo sapiens (Human)
Description:O75164
Residue:1064
Sequence:
MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYD
DIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERK
YWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGM
WKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRH
KMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYG
KQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELP
PRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDL
SSEQYEMTECPAALAPVRPTHSSVRQVEDGLTFPDYSDSTEVKFEELKNVKLEEEDEEEE
QAAAALDLSVNPASVGGRLVFSGSKKKSSSSLGSGSSRDSISSDSETSEPLSCRAQGQTG
VLTVHSYAKGDGRVTVGEPCTRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPL
SKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNET
MAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI
NLSTPYLEEDGTSILVSCKKCSVRVHASCYGVPPAKASEDWMCSRCSANALEEDCCLCSL
RGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCIFCKKRRKRT
AGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSIT
AGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEG
EVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSV
ASDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYRAIME
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM320363
NameBDBM320363
Synonyms:2-(2-methylphenyl)-1H- pyrrolo[3,2-b]pyridine-7- carboxylic acid | US10174026, Example 3 | US9738637, Example 3
TypeSmall organic molecule
Emp. Form.C15H12N2O2
Mol. Mass.252.268
SMILESCc1ccccc1-c1cc2nccc(C(O)=O)c2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a