Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase IV
LigandBDBM11386
Substrate/CompetitorBDBM11326
Meas. Tech.Carbonic Anhydrase Enzyme Inhibition Assay
Ki 156±n/a nM
Citation Scozzafava, ASupuran, CT Carbonic anhydrase and matrix metalloproteinase inhibitors: sulfonylated amino acid hydroxamates with MMP inhibitory properties act as efficient inhibitors of CA isozymes I, II, and IV, and N-hydroxysulfonamides inhibit both these zinc enzymes. J Med Chem43:3677-87 (2000) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase IV
Name:Carbonic anhydrase
Synonyms:CA-IV | Carbonate dehydratase IV | Carbonic anhydrase 4
Type:Enzyme
Mol. Mass.:35152.74
Organism:Bos taurus (bovine)
Description:Bovine isozyme, isolated from lung microsomes
Residue:312
Sequence:
MRLLLALLVLAAAPPQARAASHWCYQIQVKPSNYTCLEPDEWEGSCQNNRQSPVNIVTAK
TQLDPNLGRFSFSGYNMKHQWVVQNNGHTVMVLLENKPSIAGGGLSTRYQATQLHLHWSR
AMDRGSEHSFDGERFAMEMHIVHEKEKGLSGNASQNQFAEDEIAVLAFMVEDGSKNVNFQ
PLVEALSDIPRPNMNTTMKEGVSLFDLLPEEESLRHYFRYLGSLTTPTCDEKVVWTVFQK
PIQLHRDQILAFSQKLFYDDQQKVNMTDNVRPVQSLGQRQVFRSGAPGLLLAQPLPTLLA
PVLACLTVGFLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11386
NameBDBM11386
Synonyms:Hydroxysulfonamide 67 | N-hydroxy-2,4,6-trimethylbenzene-1-sulfonamide
TypeSmall organic molecule
Emp. Form.C9H13NO3S
Mol. Mass.215.269
SMILESCc1cc(C)c(c(C)c1)S(=O)(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM11326
NameBDBM11326
Synonyms:4-nitrophenyl acetate | p-Nitrophenyl Acetate
TypeSmall organic molecule
Emp. Form.C8H7NO4
Mol. Mass.181.1455
SMILESCC(=O)Oc1ccc(cc1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: