Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNEDD8-conjugating enzyme UBE2F
LigandBDBM320966
Substrate/Competitorn/a
Meas. Tech.Nedd8 Conjugation Inhibitory Activity
IC50 15.0±n/a nM
Citation Mizutani, TYoshimura, CKondo, HKitade, MOhkubo, S Pyrrolopyrimidine compound or salt thereof and compositions containing the pyrrolopyrimidine compound or salt thereof US Patent US10174040 Publication Date 1/8/2019
More Info.:Get all data from this article,  Assay Method
 
NEDD8-conjugating enzyme UBE2F
Name:NEDD8-conjugating enzyme UBE2F
Synonyms:NCE2 | NEDD8 carrier protein UBE2F | NEDD8 protein ligase UBE2F | NEDD8-conjugating enzyme 2 | RING-type E3 NEDD8 transferase UBE2F | UBE2F | Ubiquitin-conjugating enzyme E2 F
Type:Enzyme Catalytic Domain
Mol. Mass.:21077.76
Organism:Homo sapiens (human)
Description:Q969M7
Residue:185
Sequence:
MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPN
KLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLL
REHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYI
KRYAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM320966
NameBDBM320966
Synonyms:4-Amino-7-[(2R,3R,4S,5R)-3,4-dihydroxy-5-[(sulfamoylamino)methyl]tetrahydrofuran-2-yl]-5-(2-indan-1-ylethynyl)pyrrolo[2,3-d]pyrimidine | US10174040, Example 21
TypeSmall organic molecule
Emp. Form.C22H24N6O5S
Mol. Mass.484.528
SMILESNc1ncnc2n(cc(C#CC3CCc4ccccc34)c12)[C@@H]1O[C@H](CNS(N)(=O)=O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a