Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma intracellular receptor 2
LigandBDBM321275
Substrate/Competitorn/a
Meas. Tech.Binding Assay to Sigma Receptors
Ki 310±n/a nM
Citation Melnyk, PVermersch, PCarato, POxombre-Vanteghem, BZephir, HDonnier-Marechal, M Compounds, pharmaceutical composition and their use in treating neurodegenerative diseases US Patent US10179761 Publication Date 1/15/2019
More Info.:Get all data from this article,  Assay Method
 
Sigma intracellular receptor 2
Name:Sigma intracellular receptor 2
Synonyms:Meningioma-associated protein 30 | Sigma-2 receptor | Sigma2 receptor | Transmembrane protein 97
Type:Protein
Mol. Mass.:20857.20
Organism:Human
Description:Q5BJF2
Residue:176
Sequence:
MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM321275
NameBDBM321275
Synonyms:N-[3-(benzylmethylamino)propyl]-2,4-dichlorobenzamide | US10179761, Compound 3.1.24
TypeSmall organic molecule
Emp. Form.C18H20Cl2N2O
Mol. Mass.351.27
SMILESCN(CCCNC(=O)c1ccc(Cl)cc1Cl)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a