Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 3
LigandBDBM321303
Substrate/Competitorn/a
Meas. Tech.In Vitro Functional Activity (Agonism) on Human S1P3 Receptors
EC50<10000±n/a nM
Citation Stoit, AIwema Bakker, WICoolen, HKvan Dongen, MJLeflemme, NJHobson, A Spiro-cyclic amine derivatives as S1P modulators US Patent US10179791 Publication Date 1/15/2019
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 3
Name:Sphingosine 1-phosphate receptor 3
Synonyms:EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42278.13
Organism:Homo sapiens (human)
Description:Q99500
Residue:378
Sequence:
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM321303
NameBDBM321303
Synonyms:US10179791, Compound 75
TypeSmall organic molecule
Emp. Form.C25H28ClNO4
Mol. Mass.441.947
SMILESOC(=O)CCN1CCC2(COc3cc(OCc4c(Cl)cccc4C4CC4)ccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a