Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 5
LigandBDBM321305
Substrate/Competitorn/a
Meas. Tech.In Vitro Functional Activity (Agonism) on Human S1P5 Receptors
EC50 63.1±n/a nM
Citation Stoit, AIwema Bakker, WICoolen, HKvan Dongen, MJLeflemme, NJHobson, A Spiro-cyclic amine derivatives as S1P modulators US Patent US10179791 Publication Date 1/15/2019
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 5
Name:Sphingosine 1-phosphate receptor 5
Synonyms:Endothelial differentiation sphingolipid G-protein-coupled receptor 8 | S1P5 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-8
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41796.42
Organism:Homo sapiens (human)
Description:n/a
Residue:398
Sequence:
MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM321305
NameBDBM321305
Synonyms:US10179791, Compound 79
TypeSmall organic molecule
Emp. Form.C24H25Cl2NO4
Mol. Mass.462.366
SMILESOC(=O)CCN1CCC2(COc3cc(OC4CCc5cc(Cl)cc(Cl)c45)ccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a