Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBRD4 BD1 (aa 42-168)
LigandBDBM321349
Substrate/Competitorn/a
Meas. Tech.IC50 Measurements for Inhibitors Using BRD4 AlphaLisa Binding Assay
IC50 4500±n/a nM
Citation Albrecht, BKBellon, SFBurdick, DJCote, ACrawford, TDakin, LAHsiao-Wei Tsui, VHewitt, MCLeBlanc, YMagnuson, SRNasveschuk, CGRomero, FATang, YTaylor, AMWang, S Therapeutic compounds and uses thereof US Patent US10183009 Publication Date 1/22/2019
More Info.:Get all data from this article,  Assay Method
 
BRD4 BD1 (aa 42-168)
Name:BRD4 BD1 (aa 42-168)
Synonyms:Bromodomain-containing protein 4 Bromo Domain 1
Type:Enzyme Catalytic Domain
Mol. Mass.:15054.68
Organism:Homo sapiens (Human)
Description:n/a
Residue:127
Sequence:
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKII
KTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKI
NELPTEE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM321349
NameBDBM321349
Synonyms:N,N-dimethyl-3-(7-oxo-6-pentyl-1H-pyrrolo[2,3-c]pyridin-4-yl)benzamide | US10183009, Example 13
TypeSmall organic molecule
Emp. Form.C21H25N3O2
Mol. Mass.351.4421
SMILESCCCCCn1cc(-c2cccc(c2)C(=O)N(C)C)c2cc[nH]c2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a