Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBRD9 (aa 134-239)
LigandBDBM321395
Substrate/Competitorn/a
Meas. Tech.IC50 measurements for inhibitors using BRD9 AlphaLisa Binding Assay
IC50 28.0±n/a nM
Citation Albrecht, BKBellon, SFBurdick, DJCote, ACrawford, TDakin, LAHsiao-Wei Tsui, VHewitt, MCLeBlanc, YMagnuson, SRNasveschuk, CGRomero, FATang, YTaylor, AMWang, S Therapeutic compounds and uses thereof US Patent US10183009 Publication Date 1/22/2019
More Info.:Get all data from this article,  Assay Method
 
BRD9 (aa 134-239)
Name:BRD9 (aa 134-239)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:38439.06
Organism:Homo sapiens (human)
Description:n/a
Residue:346
Sequence:
AENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVAN
EYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNEDTAVEE
PVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVLALVEHAADEARDR
INRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLSSKLLPGFTTLGFK
DERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQCALSLQEFVKDAG
SYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM321395
NameBDBM321395
Synonyms:3-[6-[(E)-but-2-enyl]-7-oxo-1H-pyrrolo[2,3-c]pyridin-4-yl]-N-isobutyl-4-methoxy-benzamide | US10183009, Example 70
TypeSmall organic molecule
Emp. Form.C23H27N3O3
Mol. Mass.393.4788
SMILESCOc1ccc(cc1-c1cn(C\C=C\C)c(=O)c2[nH]ccc12)C(=O)NCC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a