Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-RAF (Y340D Y341D)
LigandBDBM322537
Substrate/Competitorn/a
IC50<4±n/a nM
Citation Bingham, MTestar, RGignoux, C Fused bicyclic (hetero)aromatic compounds useful for the treatment of cancers US Patent US10183939 Publication Date 1/22/2019
More Info.:Get all data from this article,  Assay Method
 
C-RAF (Y340D Y341D)
Name:C-RAF (Y340D Y341D)
Synonyms:RAF proto-oncogene serine/threonine-protein kinase (c-Raf)(Y340D)(Y341D)
Type:Serine/threonine-protein kinase
Mol. Mass.:72984.33
Organism:Homo sapiens (Human)
Description:P04049 Y340D Y341D
Residue:648
Sequence:
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSDDWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM322537
NameBDBM322537
Synonyms:5-[3-[5-(2,3-dihydro-1,4-benzodioxin-6-yl)-1H-imidazol-2-yl]chroman-6-yl]oxy-3,4-dihydro-1H-1,8-naphthyridin-2-one | US10183939, Example 15
TypeSmall organic molecule
Emp. Form.C28H24N4O5
Mol. Mass.496.514
SMILESO=C1CCc2c(Oc3ccc4OCC(Cc4c3)c3ncc([nH]3)-c3ccc4OCCOc4c3)ccnc2N1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a