Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPPAR delta protein
LigandBDBM323603
Substrate/Competitorn/a
Meas. Tech.Luciferase Assay
EC50 229±n/a nM
Citation Downes, MEvans, RKluge, ALagu, BMiura, MPanigrahi, SKPatane, MSamajdar, SSenaiar, RTakahashi, T PPAR agonists, compounds, pharmaceutical compositions, and methods of use thereof US Patent US10188627 Publication Date 1/29/2019
More Info.:Get all data from this article,  Assay Method
 
PPAR delta protein
Name:PPAR delta protein
Synonyms:PPAR delta
Type:n/a
Mol. Mass.:49664.60
Organism:Rattus norvegicus (Rat)
Description:Q62879
Residue:440
Sequence:
MEQPQEETPEAREEEKEEVATGDGAPELNGGPEHTLPSSSCTDLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLKYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQQNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFIIHDIETLWQAEKGLVWKQLVNGPPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSIRKPFSDIIEPKFEFAVKFNALELVDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILQALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM323603
NameBDBM323603
Synonyms:Synthesis of 6-(2-((4-(furan-2-yl)-N-methylbenzamido)methyl)phenoxy)-2-methylhexanoic acid | US10188627, Compound 8o
TypeSmall organic molecule
Emp. Form.C26H29NO5
Mol. Mass.435.5122
SMILESCC(CCCCOc1ccccc1CN(C)C(=O)c1ccc(cc1)-c1ccco1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a