Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor delta
LigandBDBM323618
Substrate/Competitorn/a
Meas. Tech.Luciferase Assay
EC50 4.81±0.0 nM
Citation Downes, MEvans, RKluge, ALagu, BMiura, MPanigrahi, SKPatane, MSamajdar, SSenaiar, RTakahashi, T PPAR agonists, compounds, pharmaceutical compositions, and methods of use thereof US Patent US10188627 Publication Date 1/29/2019
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor delta
Name:Peroxisome proliferator-activated receptor delta
Synonyms:NR1C2 | NUC1 | NUCI | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR delta | PPAR-beta | PPARB | PPARD | Peroxisome proliferator-activated receptor beta
Type:Enzyme
Mol. Mass.:49910.45
Organism:Homo sapiens (Human)
Description:Q03181
Residue:441
Sequence:
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM323618
NameBDBM323618
Synonyms:US10188627, Comparator Cmpd. 2
TypeSmall organic molecule
Emp. Form.C27H29NO5
Mol. Mass.447.5229
SMILESOC(=O)CCCCCOc1ccccc1CN(C1CC1)C(=O)c1ccc(cc1)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a