Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 4B2
LigandBDBM325646
Substrate/Competitorn/a
Meas. Tech.HTRF Assay
IC50<1±n/a nM
Citation Amari, GArmani, EBlackaby, WVan De Poeol, HBaker-Glenn, CTrivedi, N Aminoester derivatives US Patent US9636336 Publication Date 5/2/2017
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 4B2
Name:phosphodiesterase 4B2
Synonyms:n/a
Type:Enzyme
Mol. Mass.:64320.36
Organism:Homo sapiens (Human)
Description:Q07343-2
Residue:564
Sequence:
MKEHGGTFSSTGISGGSGDSAMDSLQPLQPNYMPVCLFAEESYQKLAMETLEELDWCLDQ
LETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPT
QKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNI
FNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAA
DVAQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDE
SVLENHHLAVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTM
VETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDK
ERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWY
QSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVID
PENRDSLGETDIDIATEDKSPVDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM325646
NameBDBM325646
Synonyms:US9636336, Example 109 | US9636336, Example 37 | [(1S)-2-(3,5-dichloro-1-oxido-pyridin-1-ium-4-yl)-1-(3,4-dimethoxyphenyl)ethyl]5-[[[1-(hydroxymethyl)-2-[(1-methyl-4-piperidyl)methoxy]-2-oxo-1-(2-thienyl)ethyl]amino]methyl]thiophene-2-carboxylate
TypeSmall organic molecule
Emp. Form.C35H39Cl2N3O8S2
Mol. Mass.764.735
SMILESCOc1ccc(cc1OC)[C@H](Cc1c(Cl)c[n+]([O-])cc1Cl)OC(=O)c1ccc(CNC(CO)(C(=O)OCC2CCN(C)CC2)c2cccs2)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a