Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM325650
Substrate/Competitorn/a
Meas. Tech.M3 Binding Assay
IC50 5.5±n/a nM
Citation Amari, GArmani, EBlackaby, WVan De Poeol, HBaker-Glenn, CTrivedi, N Aminoester derivatives US Patent US9636336 Publication Date 5/2/2017
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M3
Synonyms:CHRM3 | Cholinergic, muscarinic M3 | Muscarinic Receptors M3 | Muscarinic receptor M3 | RecName: Full=Muscarinic acetylcholine receptor M3
Type:Enzyme
Mol. Mass.:66151.03
Organism:Homo sapiens (Human)
Description:P20309
Residue:590
Sequence:
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM325650
NameBDBM325650
Synonyms:US9636336, Example 44 | US9636336, Example 45 | [(1S)-1-[3-(cyclopropylmethoxy)-4-(difluoromethoxy)phenyl]-2-(3,5-dichloro-1-oxido-pyridin-1-ium-4-yl)ethyl]5-[[[2-oxo-1-phenyl-2-(quinuclidin-4-ylmethoxy)ethyl]amino]methyl]thiophene-2-carboxylate
TypeSmall organic molecule
Emp. Form.C40H41Cl2F2N3O7S
Mol. Mass.816.737
SMILES[O-][n+]1cc(Cl)c(C[C@H](OC(=O)c2ccc(CNC(C(=O)OCC34CCN(CC3)CC4)c3ccccc3)s2)c2ccc(OC(F)F)c(OCC3CC3)c2)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a