Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 4B2
LigandBDBM325629
Substrate/Competitorn/a
Meas. Tech.HTRF Assay
IC50<1±n/a nM
Citation Amari, GArmani, EBlackaby, WVan De Poeol, HBaker-Glenn, CTrivedi, N Aminoester derivatives US Patent US9636336 Publication Date 5/2/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 4B2
Name:phosphodiesterase 4B2
Synonyms:n/a
Type:Enzyme
Mol. Mass.:64320.36
Organism:Homo sapiens (Human)
Description:Q07343-2
Residue:564
Sequence:
MKEHGGTFSSTGISGGSGDSAMDSLQPLQPNYMPVCLFAEESYQKLAMETLEELDWCLDQ
LETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPT
QKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNI
FNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAA
DVAQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDE
SVLENHHLAVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTM
VETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDK
ERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWY
QSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVID
PENRDSLGETDIDIATEDKSPVDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM325629
NameBDBM325629
Synonyms:US9636336, Example 19 | US9636336, Example 79 | US9636336, Example 80 | [(1S)-2-(3,5-dichloro-1-oxido-pyridin-1-ium-4-yl)-1-(3,4-dimethoxyphenyl)ethyl]5-[[[2-[(1-ethyl-4-piperidyl)methoxy]-2-oxo-1-phenyl-ethyl]amino]methyl]thiophene-2-carboxylate
TypeSmall organic molecule
Emp. Form.C37H41Cl2N3O7S
Mol. Mass.742.708
SMILESCCN1CCC(COC(=O)C(NCc2ccc(s2)C(=O)O[C@@H](Cc2c(Cl)c[n+]([O-])cc2Cl)c2ccc(OC)c(OC)c2)c2ccccc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a