Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase ERK2
LigandBDBM193769
Substrate/Competitorn/a
Meas. Tech.ERK-2 Enzymatic Assay
pH7.3±n/a
IC50 117±n/a nM
Commentsextracted
Citation Blake, JFCook, AGaudino, JGunawardana, IWHicken, EJHunt, KWLyon, MMetcalf, ATMohr, PJMoreno, DANewhouse, BRen, LSchwarz, JChen, HGazzard, LSchmidt, JDo, S Serine/threonine kinase inhibitors US Patent US9670208 Publication Date 6/6/2017
More Info.:Get all data from this article,  Assay Method
 
MAP kinase ERK2
Name:MAP kinase ERK2
Synonyms:Human ERK-2 | Mitogen Activated Kinase 1 | Mitogen-activated protein kinase 1 (ERK-2)
Type:n/a
Mol. Mass.:40835.09
Organism:Homo sapiens (human)
Description:8-360
Residue:353
Sequence:
GAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQR
TLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHIC
YFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEY
VATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSP
SQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQA
LAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM193769
NameBDBM193769
Synonyms:US9670208, Example 387 4-(3-(morpholin-2-yl)-[1,2,4]triazolo[4,3-a]pyridin-7-yl)-N-(tetrahydro-2H-pyran-4-yl)pyrimidin-2-amine
TypeSmall organic molecule
Emp. Form.C19H23N7O2
Mol. Mass.381.4316
SMILESC1COC(CN1)c1nnc2cc(ccn12)-c1ccnc(NC2CCOCC2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a