Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 2
LigandBDBM327281
Substrate/Competitorn/a
Meas. Tech.Biological Assay
IC50 60.0±n/a nM
Citation Yuan, HBeard, RLGarst, MEDonello, JELiu, XViswanath, V Sulfur derivatives as chemokine receptor modulators US Patent US9663460 Publication Date 5/30/2017
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 2
Name:C-C chemokine receptor type 2
Synonyms:C-C chemokine receptor type 2 (CCR2) | Chemoattractant Cytokine Receptor 2 (CCR2) | Chemokine Receptor Type 2b (CCR2b) | Monocyte chemotactic protein-1 (MCP-1)
Type:Enzyme
Mol. Mass.:41932.32
Organism:Homo sapiens (Human)
Description:P41597
Residue:374
Sequence:
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY
HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK
CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR
AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSI
GRAPEASLQDKEGA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM327281
NameBDBM327281
Synonyms:N-{5-chloro-2-[(1H-imidazol-2-ylmethyl)thio]-phenyl}-1-benzofuran-2-sulfonamide | US9663460, Example 71
TypeSmall organic molecule
Emp. Form.C18H14ClN3O3S2
Mol. Mass.419.905
SMILESClc1ccc(SCc2ncc[nH]2)c(NS(=O)(=O)c2cc3ccccc3o2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a