Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-1 (MMP1)
LigandBDBM11847
Substrate/CompetitorBDBM11446
Meas. Tech.MMP Enzyme Inhibition Assay
pH6±n/a
Temperature295.15±n/a K
Ki 9000±n/a nM
Citation Scozzafava, ASupuran, CT Protease inhibitors: synthesis of matrix metalloproteinase and bacterial collagenase inhibitors incorporating 5-amino-2-mercapto-1,3,4-thiadiazole zinc binding functions. Bioorg Med Chem Lett12:2667-72 (2002) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Matrix metalloproteinase-1 (MMP1)
Name:Matrix metalloproteinase (1 and 13)
Synonyms:Fibroblast collagenase | Interstitial collagenase | MMP1 | Matrix metalloproteinase-1 | Matrix metalloproteinase-1 (MMP-1)
Type:Enzyme
Mol. Mass.:54010.26
Organism:homo sapiens (human)
Description:
Residue:469
Sequence:
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11847
NameBDBM11847
Synonyms:2-[(2,3,4,5,6-pentafluorobenzene)sulfonamido]-3-phenyl-N-{1-[(5-sulfanyl-1,3,4-thiadiazol-2-yl)carbamoyl]ethyl}propanamide | 5-mercapto-1,3,4-thiadiazole 12m
TypeSmall organic molecule
Emp. Form.C20H16F5N5O4S3
Mol. Mass.581.559
SMILESCC(NC(=O)C(Cc1ccccc1)NS(=O)(=O)c1c(F)c(F)c(F)c(F)c1F)C(=O)Nc1nnc(S)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM11446
NameBDBM11446
Synonyms:AcProLeuGly-S-LeuLeuGlyOEt | MMP Thioester Substrate
Typen/a
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure