Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycine transporter 1
LigandBDBM327840
Substrate/Competitorn/a
Meas. Tech.Cell-Based Assay
IC50 1190±n/a nM
Citation Hitchcock, SAAmegadzie, AQian, WXia, XHarried, SS Glycine transporter-1 inhibitors US Patent US9663476 Publication Date 5/30/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Glycine transporter 1
Name:Glycine transporter 1
Synonyms:GlyT-1 | GlyT1 | Glycine Transporters (GlyT1c) | Sodium- and chloride-dependent glycine transporter 1 | Sodium- and chloride-dependent glycine transporter 1 (GlyT1) | Sodium- and chloride-dependent glycine transporter 1 (GlyT1c) | Sodium-and chloride-dependent glycine transporter 1 (GlyT-1c) | Solute carrier family 6 member 9
Type:Enzyme
Mol. Mass.:78270.54
Organism:Homo sapiens (Human)
Description:P48067
Residue:706
Sequence:
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKV
WHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGL
GNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKG
VGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTN
GSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLV
VFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKV
WGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF
MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETL
VTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVIS
CIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITY
NHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLE
HRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM327840
NameBDBM327840
Synonyms:(R)-2-((R)-4-(bis(4-chlorophenyl)methyl)-2-methylpiperazin-1-yl)propanoic acid | US9663476, Compound 82
TypeSmall organic molecule
Emp. Form.C21H24Cl2N2O2
Mol. Mass.407.333
SMILESC[C@@H](N1CCN(C[C@H]1C)C(c1ccc(Cl)cc1)c1ccc(Cl)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a