Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target72 kDa type IV collagenase
LigandBDBM11882
Substrate/CompetitorMMP Fluorogenic Peptide Substrate
Meas. Tech.Enzyme Inhibition Assay
Ki 0.3±n/a nM
Citation Becker, DPVillamil, CIBarta, TEBedell, LJBoehm, TLDecrescenzo, GAFreskos, JNGetman, DPHockerman, SHeintz, RHoward, SCLi, MHMcDonald, JJCarron, CPFunckes-Shippy, CLMehta, PPMunie, GESwearingen, CA Synthesis and structure-activity relationships of beta- and alpha-piperidine sulfone hydroxamic acid matrix metalloproteinase inhibitors with oral antitumor efficacy. J Med Chem48:6713-30 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
72 kDa type IV collagenase
Name:72 kDa type IV collagenase
Synonyms:72 kDa gelatinase | 72 kDa type IV collagenase precursor | Gelatinase A | Gelatinase A (MMP-2) | Matrix metalloproteinase-2 | Matrix metalloproteinase-2 (MMP 2) | Matrix metalloproteinase-2 (MMP2) | Matrix metalloproteinases 2 (MMP-2) | TBE-1
Type:Enzyme
Mol. Mass.:73870.36
Organism:Homo sapiens (Human)
Description:
Residue:660
Sequence:
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11882
NameBDBM11882
Synonyms:N-Hydroxy-1-(2-methoxyethyl)-4-{[4-(phenylthio)-phenyl]sulfonyl}piperidine-4-carboxamide Hydrochloride | N-hydroxy-1-(2-methoxyethyl)-4-{[4-(phenylsulfanyl)benzene]sulfonyl}piperidine-4-carboxamide hydrochloride | alpha-sulfone 35c
TypeSmall organic molecule
Emp. Form.C21H26N2O5S2
Mol. Mass.450.572
SMILESCOCCN1CCC(CC1)(C(=O)NO)S(=O)(=O)c1ccc(Sc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
MMP Fluorogenic Peptide Substrate
Name:MMP Fluorogenic Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:2468.31
Organism:n/a
Description:n/a
Residue:23
Sequence:
MCA-Pro-Leu-Gly-Leu-Dpa-Ala-Arg-NH2