Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 12
LigandBDBM161376
Substrate/Competitorn/a
Meas. Tech.p38 MAPKγ Enzyme Inhibition
IC50 3739±n/a nM
Citation Ito, KCharron, CEKing-Underwood, JOnions, STLongshaw, AI 1-pyrazolyl-3-(4-((2-anilinopyrimidin-4-yl)oxy)napththalen-1-yl) ureas as P38 MAP knase inhibitors US Patent US9724347 Publication Date 8/8/2017
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 12
Name:p38 delta/gamma
Synonyms:MAP kinase p38 gamma | Mitogen-activated protein kinase 12 (MAPK12 p38 gamma) | Mitogen-activated protein kinase 12 (p38 gamma) | Mitogen-activated protein kinase p38 gamma (p38 MAPKγ)
Type:Protein
Mol. Mass.:41938.69
Organism:Homo sapiens (Human)
Description:P53778
Residue:367
Sequence:
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM161376
NameBDBM161376
Synonyms:US9108950, 1 | US9724347, Example 1
TypeSmall organic molecule
Emp. Form.C35H33N7O2
Mol. Mass.583.6822
SMILESCc1ccc(cc1)-n1nc(cc1NC(=O)Nc1ccc(Oc2ccnc(Nc3ccccc3)n2)c2ccccc12)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a